PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03476.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CPP
Protein Properties Length: 356aa    MW: 39548.6 Da    PI: 8.2852
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03476.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR452.1e-1467104441
                             TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                     k C CkkskClk+YC Cf +g++Cse+C C+ C+Nk++
  Zmw_sc03476.1.g00010.1.sm.mkhc  67 KYCACKKSKCLKLYCPCFTDGSYCSEKCGCQPCFNKDS 104
                                     78*********************************975 PP

2TCR48.32e-15151187339
                             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                     ++gCnCkks+ClkkYC+C+++g+ Cs  C+Ce C+N 
  Zmw_sc03476.1.g00010.1.sm.mkhc 151 RRGCNCKKSSCLKKYCDCYQEGTGCSLFCRCEACQNP 187
                                     589*********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-1164105IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.26665189IPR005172CRC domain
PfamPF036381.1E-1067102IPR005172CRC domain
SMARTSM011145.3E-14149190IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.5E-11152186IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEATPISMKP PSPAAVATPP TAVEPQFSPQ PAAGAAEAEP GGMNQLVLTS NVKRQRVDEA  60
ADGNGFKYCA CKKSKCLKLY CPCFTDGSYC SEKCGCQPCF NKDSYAETVQ ATRKVLLSRQ  120
KRMSLKINRR SETNAEAMED AHNSSSSTPP RRGCNCKKSS CLKKYCDCYQ EGTGCSLFCR  180
CEACQNPFGK NEGIMAEDSR RYLYTGADLD HSEGEHEFVV ERSPRLQSPI SKESSFQTPP  240
HLRASSRDTH AFPQALSQWQ PLPRSGHCSK RNSNDRVMDD SGNYKYSSHG WLLSKHEDSY  300
SISKCIQILN GMVELSQVEK SVAPDVFLQQ GNREIFISLG GEVRALWLKR KIQHLT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441351.10.0hypothetical protein SORBIDRAFT_09g025040
TrEMBLA0A0A8ZWM00.0A0A0A8ZWM0_ARUDO; Uncharacterized protein
STRINGSb09g025040.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101592937